| Accession 1: DV492627
(GenBank)
| | Gene: 0 |
|
Accession 2:
| |
Library Index: IUG35_RS-K-16 |
Gene Names:
|
Categories:
|
|
GO Categories:
|
Molecular Function
molecular_function unknown
GO Numbers
signal transducer activity
GO Numbers
transporter activity
GO Numbers
antioxidant activity
GO Numbers
catalytic activity
GO Numbers
triplet codon-amino acid adaptor activity
GO Numbers
enzyme regulator activity
GO Numbers
transcription regulator activity
GO Numbers
binding
GO Numbers
motor activity
GO Numbers
structural molecule activity
GO Numbers
nutrient reservoir activity
GO Numbers
chaperone regulator activity
GO Numbers
|
Biological Process behavior
GO Numbers
physiological process
GO Numbers
cellular process
GO Numbers
biological_process unknown
GO Numbers
regulation of biological process
GO Numbers
development
GO Numbers
viral life cycle
GO Numbers
|
Cell Component cellular_component unknown
GO Numbers
extracellular region
GO Numbers
virion
GO Numbers
cell
GO Numbers
organelle
GO Numbers
extracellular matrix
GO Numbers
protein complex
GO Numbers
|
| Light Intensity Reads |
P-Value |
Fold Change |
| Low |
6.05e-05 |
335.997 |
| Medium |
0.000773152 |
55.9054 |
| High |
4.56e-06 |
22.9026 |
|
|
Show/Hide Reading Frames/PsortPrediction
------ Reading Frame 1------------ 8 stop codons---------- PSORT Prediction this frame--------
| FFFFFFK**PN*RLRFREGTVVQSIKYS*LDCSPTHHTRNRQRRNQSFFMQRYVQVLHH* |
| ILSHGHRCHT*DILIHHCNCSHVRGPSAYWCRDAGSC*PAILLLHHGGRLD*LDRGSGVI |
| CSHGFLGLDHTTIGACSCLLFFSFLSNLAILSWLNDACRGCSVL |
------ Reading Frame 2------------ 2 stop codons---------- PSORT Prediction this frame--------
| FFFFFLNSDQIKG*DFEKVLSFKASSIHD*IVALHITQEIGRGGTNRFSCNATFKFFTIR |
| FYHTDIVVTPETSLSTIATAAMSEAPVRTGVEMQDHADLPFSCCITVDALIDLTGEVASS |
| ALTVSLAWITPPLVPAAACSSSASLAISPSSAGSMMHAVDAVFF |
------ Reading Frame 3------------ 8 stop codons---------- PSORT Prediction this frame--------
| FFFFF*IVTKLKVKISRRYCRSKHQVFMTRL*PYTSHKK*AEAEPIVFHATLRSSSSPLD |
| FITRTSLSHLRHPYPPLQLQPCPRPQCVLV*RCRIMLTCHSPAASRWTP*LT*QGKWRHL |
| LSRFPWLGSHHHWCLQLPALLQLP*QSRHPQLAQ*CMPWMQCS |
------ Reading Frame 4------------ 10 stop codons---------- PSORT Prediction this frame--------
| EEHCIHGMHH*AS*GWRDC*GS*RRAGSCRHQWWCDPSQGNRESR*RHFPCQVNQGVHRD |
| AAGEWQVSMILHLYTSTHWGLGHGCSCNGG*GCLRCDNDVRVIKSNGEELERSVA*KTIG |
| SASAYFLCDV*GYNLVMNT*CFERQYLLEILTFNLVTI*KKKKK |
------ Reading Frame 5------------ 6 stop codons---------- PSORT Prediction this frame--------
| KNTASTACIIEPAEDGEIAKEAEEEQAAAGTNGGVIQAKETVRADDATSPVKSIKASTVM |
| QQENGRSA*SCISTPVRTGASDMAAVAMVDKDVSGVTTMSV**NLMVKNLNVALHEKRLV |
| PPLPISCVMCRATI*S*ILDALNDSTFSKS*PLIWSLFKKKKKK |
------ Reading Frame 6------------ 11 stop codons---------- PSORT Prediction this frame--------
| RTLHPRHASLSQLRMARLLRKLKKSRQLQAPMVV*SKPRKP*EQMTPLPLSSQSRRPP*C |
| SRRMAGQHDPASLHQYALGPRTWLQLQWWIRMSQV*QRCPCDKI*W*RT*T*RCMKNDWF |
| RLCLFLV*CVGLQSSHEYLML*TTVPSRNLNL*FGHYLKKKKK |
|
|
Researcher: DJ-B (djb checked), (eneda h rechecked) |
|
Last Updated: 2006-07-17
|
Notes:Replaces accession AI881720
Identified a predicted gene on MAGI_84099 that had a much longer sequence than DV492627. Ran this sequnece through InterProScan and performed a blastx of genbank: >FGENESHMAGI_84099.1 class=mRNA position=MAGI_84099:1..1936 (+ strand)
Highest hits with accessions annotated as "unknown protein". Additional hits with zinc finger proteins, see InterProScan results below.
>gi|50726117|dbj|BAD33638.1| unknown protein [Oryza sativa (japonica cultivar-group)] Length=328
Score = 58.5 bits (140), Expect = 1e-06 Identities = 50/224 (22%), Positives = 80/224 (35%), Gaps = 57/224 (25%) Frame = +3
IPR003604 Zinc finger, U1-type
Contains
|
IPR007087 Zinc finger, C2H2-type
|
Function
|
GO:0003676 nucleic acid binding GO:0008270 zinc ion binding
|
Component
|
GO:0005634 nucleus
|
Abstract
|
Zinc finger domains [ 1 , 2 ] are nucleic acid-binding protein structures first identified in the Xenopus laevis transcription factor TFIIIA. These domains have since been found in numerous nucleic acid-binding proteins. A zinc finger domain is composed of 25 to 30 amino-acid residues including 2 conserved Cys and 2 conserved His residues in a C-2-C-12-H-3-H type motif. The 12 residues separating the second Cys and the first His are mainly polar and basic, implicating this region in particular in nucleic acid binding. The zinc finger motif is an unusually small, self-folding domain in which Zn is a crucial component of its tertiary structure. All bind 1 atom of Zn in a tetrahedral array to yield a finger-like projection, which interacts with nucleotides in the major groove of the nucleic acid. The Zn binds to the conserved Cys and His residues. Fingers have been found to bind to about 5 base pairs of nucleic acid containing short runs of guanine residues. They have the ability to bind to both RNA and DNA, and it has been suggested that the zinc finger may thus represent the original nucleic acid binding protein. It has also been suggested that a Zn-centred domain could be used in a protein interaction, e.g. in protein kinase C. Many classes of zinc fingers are characterized according to the number and positions of the histidine and cysteine residues involved in the zinc atom coordination. In the first class to be characterized, called C2H2, the first pair of zinc coordinating residues are cysteines, while the second pair are histidines.
U1-type zinc fingers are a family of C2H2-type zinc fingers present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
|
|
|